PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10013081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 478aa    MW: 53913.8 Da    PI: 9.9376
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10013081genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.5e-12257300148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+ Ed+ll+++v  +G + W+     +g++Rt+k+c++rw++yl
      Lus10013081 257 KGQWTPKEDKLLIQLVGVHGLKKWSV----IGLKRTGKSCRLRWLNYL 300
                      799***********************....7889************97 PP

2Myb_DNA-binding53.94.1e-17306349146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ d++ ++G++ W++Ia++++ gRt++++k++w++
      Lus10013081 306 RGNITPEEQLLIMDLHSKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 349
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.253252300IPR017930Myb domain
SuperFamilySSF466897.11E-28256347IPR009057Homeodomain-like
SMARTSM007174.7E-9256302IPR001005SANT/Myb domain
PfamPF002491.1E-11257300IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-19258307IPR009057Homeodomain-like
CDDcd001672.84E-10260300No hitNo description
PROSITE profilePS5129425.553301355IPR017930Myb domain
SMARTSM007171.4E-15305353IPR001005SANT/Myb domain
PfamPF002491.8E-15306349IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-24308356IPR009057Homeodomain-like
CDDcd001677.98E-12310349No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MLSHPFFVVW LESQGRDGVP HGRGKKEDHE HAMKVCHKRN ETCHGSTLVE LPLRILFKAT  60
TSFRSRIANA LLKPQKFDEV SSVFSSSSSS SANKPPVHDI PVLLPPPPPY FPSKINPIRD  120
LKRGFPSSSP TKHHHHHYHF HCHHNTGHLS PKNDVNSEIH LLLTGDSGNN NNYYRDNNDL  180
NLLAGGVRSS QEQDDKGKKI ENDDKIPGLT FPNPTSRGKE LLTVDKKAQQ IPIKAPAVVE  240
KMKKNTEPNL EKPLIIKGQW TPKEDKLLIQ LVGVHGLKKW SVIGLKRTGK SCRLRWLNYL  300
RPDVRRGNIT PEEQLLIMDL HSKWGNRWSK IAKHLPGRTD NEIKNYWRTR IHKHLKQADH  360
HNQQQQMFPS GHLGIGLDQI MNMSRETSAS NNNNNTSQVS ADTMEMDYSP PASHHHYNHH  420
HHLDAGFHRA SAGPTNNIAA SGSSSNMPPP PPPPESAEGY SWSIEELWSM QLLNGDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-242543551105C-Myb DNA-Binding Domain
1msf_C1e-242543551105C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.12e-53myb domain protein 21